blastxmlparser is a very fast parallel big-data BLAST XML file parser, which can be used as command line utility. Use blastxmlparser to:
- Parse BLAST XML
- Filter output
- Generate FASTA, JSON, YAML, RDF, JSON-LD, HTML, csv, tabular output etc.
Rather than loading everything in memory, XML is parsed by BLAST query (Iteration). Not only has this the advantage of low memory use, it also shows results early, and it is faster when IO continues in parallel (disk read-ahead).
blastxmlparser comes as a command line utility, which can be used to filter results and requires no understanding of Ruby.
gem install bio-blastxmlparser
gem install parallel # if you want multi-core support
blastxmlparser --helpXML parsing and transformation is expensive. blastxmlparser can use the fast Nokogiri C, or Java XML parsers, based on libxml2 in parallel. A DOM parser is used after splitting the BLAST XML document into subsections. Tests show this is faster than a SAX parser with Ruby callbacks. To see why libxml2 based Nokogiri is fast, see xml.com. And blastxmlparser uses Nokogiri in parallel.
Blastxmlparser is designed with other optimizations, such as lazy evaluation, i.e., only creating objects when required. When parsing a full BLAST result usually only a few fields are used. By using XPath queries the parser makes sure only the relevant fields are queried.
Timings for parsing a 1 Gb BLAST XML file on 4-core 1.2GHz laptop
real 2m40.248s
user 8m11.075s
sys 0m37.198s
which makes for pretty good core utilisation and limited RAM use. If you have enough RAM it may make sense to try the `--parser nosplit' option which starts by reading the full DOM into RAM. It may be faster and show different IO characteristics.
gem install parallel bio-blastxmlparserImportant: the parser is written for Ruby 1.9 or later. Check with
ruby -v
gem envNokogiri XML parser is required. To install it, the libxml2 libraries and headers may need to be installed first, for example on Debian:
apt-get install libxslt-dev libxml2-dev
gem install bio-blastxmlparser blastxmlparser [options] file(s)
-p, --parser name Use split|nosplit parser (default split)
--filter filter Filtering expression
--threads num Use parallel threads
-e, --exec filter Evaluate filter (deprecated)
-n, --named fields Print named fields
--output-fasta Output FASTA
-t, --template erb Use ERB template for output
--logger filename Log to file (default stderr)
--trace options Set log level (default INFO, see bio-logger)
-q, --quiet Run quietly
-v, --verbose Run verbosely
--debug Show debug messages
-h, --help Show help and examples
Print result fields of iterations containing 'lcl', using a regex
blastxmlparser --filter 'iter.query_id=~/lcl/' test/data/nt_example_blastn.m7prints a (default) tab delimited to stdout
1 1 lcl|1_0 lcl|I_74685 1 5.82208e-34
2 1 lcl|1_0 lcl|I_1 1 5.82208e-34
3 2 lcl|2_0 lcl|I_2 1 6.05436e-59
4 3 lcl|3_0 lcl|I_3 1 2.03876e-56The second and third column show the BLAST iteration, and the others relate to the hits.
As this is evaluated Ruby, it is also possible to use the XML element names directly
blastxmlparser --filter 'hsp["Hsp_bit-score"].to_i>145' test/data/nt_example_blastn.m7Or the shorter
blastxmlparser --filter 'hsp.bit_score>145' test/data/nt_example_blastn.m7And it is possible to print (non default) named fields where E-value < 0.001 and hit length > 100. E.g.
blastxmlparser -n 'hsp.evalue,hsp.qseq' --filter 'hsp.evalue<0.01 and hit.len>100' test/data/nt_example_blastn.m7
1 5.82208e-34 AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCT...
2 5.82208e-34 AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCT...
3 2.76378e-11 AATATGGTAGCTACAGAAACGGTAGTACACTCTTC
4 1.13373e-13 CTAAACACAGGAGCATATAGGTTGGCAGGCAGGCAAAAT
5 2.76378e-11 GAAGAGTGTACTACCGTTTCTGTAGCTACCATATT
etc. etc.prints the evalue and qseq columns. To output FASTA use --output-fasta
blastxmlparser --output-fasta --filter 'hsp.evalue<0.01 and hit.len>100' test/data/nt_example_blastn.m7which prints matching sequences, where the first field is the accession, followed by query iteration id, and hit_id. E.g.
>I_74685 1|lcl|1_0 lcl|I_74685 [57809 - 57666] (REVERSE SENSE)
AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCTGCCTGCCAACCTATATGCTCCTGTGTTTAG
>I_1 1|lcl|1_0 lcl|I_1 [477 - 884]
AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCTGCCTGCCAACCTATATGCTCCTGTGTTTAG
etc. etc.Another example outputs all definitions containing a string
/blastxmlparser -n hit.hit_def --filter 'hit.hit_def=~/G. Ratti/i' To have more output options blastxmlparser can use an ERB template for every match. This is a very flexible option that can output textual formats such as JSON, YAML, HTML and RDF. Examples are provided in ./templates. A JSON template could be
{ "<%= hit.parent.query_def %>": {
"num": <%= hit.hit_num %>,
"id": "<%= hit.hit_id %>",
"len": <%= hit.len %>,
"E-value": <%= hsp.evalue %>,
"bitscore": <%= hsp.bit_score %>,
"qseq": "<%= hsp.qseq %>",
"midline": "<%= hsp.midline %>",
"hseq": "<%= hsp.hseq %>",
};To get JSON, run it with
blastxmlparser --template template/blast2json.erb --filter 'hsp.evalue<0.01 and hit.len>100' test/data/nt_example_blastn.m7{ "B0511.9d gene=WBGene00015235": {
"num": 5,
"id": "gi|268566471|ref|XP_002639731.1|",
"len": 199,
"E-value": 1.72502e-22,
"bitscore": 96.6709,
"qseq": "MSMLRRPLTQLELSVI------------------VPKCXXXXXXXXXXXXQSEPPRGITRRNLRSADRKNRDVPGPSTGECTRTSIAPNRCEMSFTEVQ-TLTSARTPVAAPTLTLSTPVNPVSSAEMLX----XXXXXXXXXXXASRSGDNDSPLLFNAYDTPQQ--GINXXXXXXXXXXXXXNAHLYAXXXXXXXXXXXXXXXXRSHRH",
"midline": "MSMLRRPLTQLEL K QSEP GI++RNLRSADR+ +DVPG ++GE + FT+ +++SARTPV+ ++ LSTPVNP SS EM+ SR + D PL+FNAYDTPQQ G + NAHLY+ RS RH",
"hseq": "MSMLRRPLTQLELCEDDIQWLSEQLAKKETGFEDEVKYEVMDVDEDEPMDQSEPTGGISKRNLRSADRRKKDVPG-TSGEGAQ-----------FTDQGLSISSARTPVSGASVNLSTPVNPSSSNEMMALPPPVRLARAGRRQRDSRVVNGDVPLMFNAYDTPQQPAGGSNGSPTPSDSPESPNAHLYSTPINPTSSSGGPSSNTRSQRH",
};Likewise, using the RDF template
blastxmlparser --template template/blast2rdf.erb --filter 'hsp.evalue<0.01 and hit.len>100' test/data/nt_example_blastn.m7:Minc_Contig50_77_42056___42484_1_64492 :query :Minc_Contig50_77_42056___42484_1_64492_23
:Minc_Contig50_77_42056___42484_1_64492_23
:query_id "lcl|30_0",
:query_def "Minc_Contig50_77 [42056 - 42484] 1 64492",
:num 23,
:accession "Minc02032",
:id "lcl|Minc02032",
:len 147,
:identity 60,
:align_len 69,
:bitscore 69.8753,
:qseq "ATGGGAGATGGAATTGAACCGTCATGGAAAGGGCCCAAACCGAAGCACAACCGACTGTGCCACCATCCA",
:midline "|||||||||||||||||||| |||||||| | |||||||||||||||||||||||||||||||",
:hseq "ATGGGAGATGGAATTGAACCATCATGGAATG-------ACCGAAGCACAACCGACTGTGCCACCATCCA",
:evalue 8.1089e-12 .Templates can also print data as a header of the JSON/YAML/RDF output. For this use the '=' prefix with HEADER, BODY, FOOTER keywords in the template. A small example can be
=HEADER
<% require 'json' %>
[
{ "HEADER": {
"options": <%= options.to_h.to_json %>,
"files": <%= ARGV %>,
"version": "<%= BLASTXML_VERSION %>"
},
=BODY
{ "<%= hit.parent.query_def.strip %>": {
"num": <%= hit.hit_num %>,
"id": "<%= hit.hit_id %>",
"len": <%= hit.len %>,
"E-value": <%= hsp.evalue %>,
},
=FOOTER
]may generate something like
[
{ "HEADER": {
"options": {"template":"template/blast2json2.erb","filter":"hsp.evalue>0.01"},
"files": ["test/data/nt_example_blastn.m7"],
"version": "2.0.2-pre1"
},
{ "I_1 [477 - 884]": {
"num": 41,
"id": "lcl|X_42251",
"len": 153,
"E-value": 0.0247015,
},
{ "I_1 [477 - 884]": {
"num": 43,
"id": "lcl|V_105720",
"len": 180,
"E-value": 0.0247015,
},
]Note that the template is not smart enough to remove the final comma from the last BODY element. To make it valid JSON that needs to be removed. A future version may add a parameter to the BODY element or a global rewrite function for this purpose. A simple
<%= ( body.last? ? "" : "," ) %>does not work here because the parallel parser does not know which line is the last.
To use the high-mem version of the parser (slightly faster on single core) use
blastxmlparser --parser nosplit --threads 1 -n 'hsp.evalue,hsp.qseq' --filter 'hsp.evalue<0.01 and hit.len>100' test/data/nt_example_blastn.m7To loop through a BLAST result:
>> require 'bio-blastxmlparser'
>> fn = 'test/data/nt_example_blastn.m7'
>> n = Bio::BlastXMLParser::XmlIterator.new(fn).to_enum
>> n.each do | iter |
>> puts "Hits for " + iter.query_id
>> iter.each do | hit |
>> hit.each do | hsp |
>> print hit.hit_id, "\t", hsp.evalue, "\n" if hsp.evalue < 0.001
>> end
>> end
>> endThe next example parses XML using less memory by using a Ruby Iterator
>> blast = Bio::BlastXMLParser::XmlSplitterIterator.new(fn).to_enum
>> iter = blast.next
>> iter.iter_num
=> 1
>> iter.query_id
=> "lcl|1_0"Get the first hit
>> hit = iter.hits.first
>> hit.hit_num
=> 1
>> hit.hit_id
=> "lcl|I_74685"
>> hit.hit_def
=> "[57809 - 57666] (REVERSE SENSE) "
>> hit.accession
=> "I_74685"
>> hit.len
=> 144Get the parent info
>> hit.parent.query_id
=> "lcl|1_0"Get the first Hsp
>> hsp = hit.hsps.first
>> hsp.hsp_num
=> 1
>> hsp.bit_score
=> 145.205
>> hsp.score
=> 73
>> hsp.evalue
=> 5.82208e-34
>> hsp.query_from
=> 28
>> hsp.query_to
=> 100
>> hsp.query_frame
=> 1
>> hsp.hit_frame
=> 1
>> hsp.identity
=> 73
>> hsp.positive
=> 73
>> hsp.align_len
=> 73
>> hsp.qseq
=> "AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCTGCCTGCCAACCTATATGCTCCTGTGTTTAG"
>> hsp.hseq
=> "AGTGAAGCTTCTAGATATTTGGCGGGTACCTCTAATTTTGCCTGCCTGCCAACCTATATGCTCCTGTGTTTAG"
>> hsp.midline
=> "|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||"Unlike BioRuby, this module uses the actual element names in the XML definition, to avoid confusion (if anyone wants a translation, feel free to contribute an adaptor).
It is also possible to use the XML element names as Strings, rather than methods. E.g.
>> hsp.field("Hsp_bit-score")
=> "145.205"
>> hsp["Hsp_bit-score"]
=> "145.205"Note that, when using the element names, the results are always String values.
Fetch the next result (Iteration)
>> iter2 = blast.next
>> iter2.iter_num
>> 2
>> iter2.query_id
=> "lcl|2_0"etc. etc.
For more examples see the files in ./spec
The project lives at https://github.com/pjotrp/blastxmlparser. If you use this software, please cite http://dx.doi.org/10.1093/bioinformatics/btq475
blastxmlparser is listed at http://biogems.info
Copyright (c) 2011-2015 Pjotr Prins under the MIT licence. See LICENSE.txt and http://www.opensource.org/licenses/mit-license.html for further details.